top of page

CircRNA

Gene

chr3|124990786|125029488|-|13|circRNA|HEG1|ENST00000311127.8|14,13,12,11,10,9,8,7,6,5,4,3,2

HEG1

Open Reading Frame (ORF)

LGRAMLLRMLQKTSLYSLKQQMLEEGAALQVEQTSPFCLLGTHWR

Peptide

AMLLRMLQK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page