top of page

CircRNA

Gene

chr3|124773689|124809156|-|3|circRNA|ITGB5|ENST00000296181.8|11,10,9

ITGB5

CircRNA UID

circITGB5(11,10,9)

Open Reading Frame (ORF)

MCEKCPTCPDACSTKRVSGLKWSCQSGISLRILISSLLLPAKMGYPILVRGSVRV

Peptide

MGYPILVRGSVR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page