top of page

CircRNA

Gene

chr3|123124065|123161455|+|8|circRNA|PDIA5|NM_006810|9,10,11,12,13,14,15,16

PDIA5

CircRNA UID

circPDIA5(9,10,11,12,13,14,15,16)

Open Reading Frame (ORF)

LPVPLLTVSKTRTKTCASRRRSRATPLSTTTTMGSSQKSMTATAQCWPG

Peptide

LPVPLLTVSKTR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page