top of page

CircRNA

Gene

chr3|121676892|121692581|—|4|circRNA|GOLGB1|ENST00000340645.9|17,16,15,14

GOLGB1

Open Reading Frame (ORF)

MREITCGMSWRNFESQRKGSRGLQLSLPPAQLKYRV

Peptide

EITCGMSWR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page