top of page

CircRNA

Gene

chr3|121519870|121539589|—|6|circRNA|POLQ|NM_199420|9,8,7,6,5,4

POLQ

Open Reading Frame (ORF)

LAATSTLSSGVNLPARRVIIRTPIFGGRPLDILTYKQMVGRAGRKGVDTVESVSGSRNKSRRLYGQHLSIKAFLFIGYCSLHN

Peptide

KGVDTVESVSGSR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page