top of page

CircRNA

Gene

chr3|119503531|119517315|+|4|circRNA|TIMMDC1|NM_016589|3,4,5,6

TIMMDC1

CircRNA UID

circTIMMDC1(3,4,5,6)

Open Reading Frame (ORF)

LLMAFQKYSGETVQERKQKDRKALHELKLEECNLHIVLPHEASFVMAGAGVGELQCL

Peptide

ALHELKLEECNLHIVLPHEASFVMAGAGVGELQCL

ORF Found in Long-Read

false

Peptide Length

35

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

26

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page