top of page

CircRNA

Gene

chr3|113612085|113619726|+|3|circRNA|SIDT1|ENST00000264852.8|19,20,21

SIDT1

CircRNA UID

circSIDT1(19,20,21)

Open Reading Frame (ORF)

MVLLVVGNLVNWSLCLEKMTYGSGSSSLQSTFWPR

Peptide

MTYGSGSSSLQSTFWPR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page