top of page

CircRNA

Gene

chr3|113420016|113433669|-|4|circRNA|CFAP44|ENST00000393845.6|5,4,3,2

CFAP44

CircRNA UID

circCFAP44(5,4,3,2)

Open Reading Frame (ORF)

LDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGRK

Peptide

SSSGEGIGVIGR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page