top of page

CircRNA

Gene

chr3|113280663|113281027|+|1|ciRNA|BOC|NM_033254|14

BOC

Open Reading Frame (ORF)

LPQLSLTMRLGSRKPYTHCHAPFSDSVSVRHSSVFIASA

Peptide

KPYTHCHAPFSDSVSVR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page