top of page

CircRNA

Gene

chr3|112344961|112349819|+|3|circRNA|CD200|NM_001004196|4,5,6

CD200

CircRNA UID

circCD200(4,5,6)

Open Reading Frame (ORF)

MLSAKCPGSPHCDMAEKESCKPRKHGHLQREPWGGDPACL

Peptide

KHGHLQR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page