top of page

CircRNA

Gene

chr3|101579789|101585511|+|2|circRNA|PCNP|ENST00000265260.7|2,3

PCNP

CircRNA UID

circPCNP(2,3)

Open Reading Frame (ORF)

LFLPVMEGKVPVAALRSDQLKKKLPTSQQSLQRSPSLDLP

Peptide

LFLPVMEGK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page