top of page

CircRNA

Gene

chr3|10078080|10081464|+|3|circRNA|FANCD2|ENST00000287647.7|30,31,32

FANCD2

CircRNA UID

circFANCD2(30,31,32)

Open Reading Frame (ORF)

MSSCYQRLLQIFHGLFAWLQKLCNLGPLSCFSCWKISPRSWRVC

Peptide

LLQIFHGLFAWLQK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page