top of page

CircRNA

Gene

chr22|49777814|49787389|—|1|ciRNA|BRD1|NM_001304809|8

BRD1

Open Reading Frame (ORF)

LRSHGSVPSGVSAATDQGLVFLHLWPGGFVVSTWVGGWEPETRGDYGPSVRPAGLRLPRWALGLLFPVGRGGVSAAVAFSLSEDPLGTSRDSFRCAVDVPGDGQASGDCAWLGCGTPLRHLLWGQRGTFLCSVFGLLGGHWEGP

Peptide

WALGLLFPVGR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page