top of page

CircRNA

Gene

chr22|46691571|46707988|—|6|circRNA|CERK|NM_022766|11,10,9,8,7,6

CERK

Open Reading Frame (ORF)

LWEVSGHQCHKHVLCLSPEPQGPLPGCPLGRRVF

Peptide

HVLCLSPEPQGPLPGCPLGR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page