top of page

CircRNA

Gene

chr22|46215172|46220014|+|3|circRNA|PPARA|ENST00000262735.9|4,5,6

PPARA

Open Reading Frame (ORF)

MPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPTRFHQLRAPPR

Peptide

VILSGKASNNPTR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page