top of page

CircRNA

Gene

chr22|43046409|43079986|—|9|circRNA|TTLL1|NM_012263|10,9,8,7,6,5,4,3,2

TTLL1

Open Reading Frame (ORF)

MTPSTSPSRMVKSQTANGTSRHLRKSSAITRFWKKEGPASVTSARPR

Peptide

EGPASVTSARPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page