top of page

CircRNA

Gene

chr22|42179608|42215341|—|2|circRNA|TCF20|NM_005650|3,2

TCF20

Open Reading Frame (ORF)

LVDKIKAPKRMILQPLKGHLAMVGQRKPVMHHFPSQSLQEEEGAKETRMAITTPTIMEKEMARVATLQRALVLRAELSLANLLEVCAIVTKIVSGQPCHEMSVAFLSILQGKKREISLAMGNERVEMKNSQASCRKCFRVTTTTLTGDILGVLKSIRGWLVA

Peptide

ETRMAITTPTIMEK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page