top of page

CircRNA

Gene

chr22|41154994|41173784|+|13|circRNA|EP300|ENST00000263253.7|17,18,19,20,21,22,23,24,25,26,27,28,29

EP300

CircRNA UID

circEP300(17,18,19,20,21,22,23,24,25,26,27,28,29)

Open Reading Frame (ORF)

LSRGNKKKPGMPNVSNDLSQKLYATMEKHKEFSNQKNYDRH

Peptide

HKEFSNQK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page