top of page

CircRNA

Gene

chr22|41151832|41152350|+|2|circRNA|EP300|ENST00000263253.7|15,16

EP300

CircRNA UID

circEP300(15,16)

Open Reading Frame (ORF)

MESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKTFPASCKH

Peptide

TFPASCK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page