top of page

CircRNA

Gene

chr22|40261831|40270280|+|2|circRNA|TNRC6B|ENST00000301923.13|7,8

TNRC6B

CircRNA UID

circTNRC6B(7,8)

Open Reading Frame (ORF)

LAALHRHQSMVATMPKGWQCRTDNRQAPPATCLGRCRRDSVASRTTKCY

Peptide

HQSMVATMPK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page