top of page

CircRNA

Gene

chr22|38751392|38752506|-|1|ciRNA|SUN2|NM_001199580|3

SUN2

CircRNA UID

ciSUN2(3)

Open Reading Frame (ORF)

LNVAPSLAAAARLAHLLVRFRENRRGRASIGRVRGMAAASCLATREPTPCTRQGRRLWLSFMLLAGLTSLLPTSA

Peptide

GRASIGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page