top of page

CircRNA

Gene

chr22|38299894|38300952|-|2|circRNA|CSNK1E|NM_152221|6,5

CSNK1E

Open Reading Frame (ORF)

LQRLSLSAASSISTPRTSSTGTSSPTTSSWGWGRRATWSTSSTSAWPRSTGTPAPTSTFPTGKTRT

Peptide

LSLSAASSISTPRTSSTGTSSPTTSSWGWGR

ORF Found in Long-Read

false

Peptide Length

31

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

22

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page