top of page

CircRNA

Gene

chr22|37815417|37816725|+|4|circRNA|GCAT|ENST00000323205.10|6,7,8,9

GCAT

CircRNA UID

circGCAT(6,7,8,9)

Open Reading Frame (ORF)

LSSGSATPWSPRARPGSGYRSQQCIARKTLTAAWRPSWKWGDCTGHCPELWGHR

Peptide

ARPGSGYRSQQCIAR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page