top of page

CircRNA

Gene

chr22|37687909|37688992|+|3|circRNA|NOL12|ENST00000493862.5|2,3,4

NOL12

CircRNA UID

circNOL12(2,3,4)

Open Reading Frame (ORF)

LDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGVPDRLPQAEGRAKEGSH

Peptide

GVPDRLPQAEGR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page