top of page

CircRNA

Gene

chr22|37566071|37566812|+|1|circRNA|CDC42EP1|ENST00000249014.4|2

CDC42EP1

Open Reading Frame (ORF)

LMPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLHLWAGELPTTSGVLSLRLNIYSCF

Peptide

LMPGPQGGRGAATMSLGK

ORF Found in Long-Read

true

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page