top of page

CircRNA

Gene

chr22|36285357|36285657|-|1|ciRNA|MYH9|NM_002473|37

MYH9

CircRNA UID

ciMYH9(37).A

Open Reading Frame (ORF)

MSRHLDLKGPPLASVLGVQKFLIFPFLGDPRLWTPRVWWDPAATFLWPCSCPPARAPALVGARTSPTLGSGWSHHGRAGLGPSRQKHRPSASCSPGA

Peptide

APALVGAR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page