top of page

CircRNA

Gene

chr22|31712082|31717291|-|1|circRNA|PRR14L|ENST00000327423.10|4

PRR14L

Open Reading Frame (ORF)

LWCKARETGISRGLQEYLVSERTGCCTYRNNWSGFRFPSYCCFYSGLSQNKKIM

Peptide

ARETGISR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page