top of page

CircRNA

Gene

chr22|31556941|31589577|+|8|circRNA|SFI1|ENST00000540643.5|6,7,8,9,10,11,12,13

SFI1

Open Reading Frame (ORF)

LLQARADGHFQQRALPAAFHTWNRLWRWRHQENVLSARATRFHRCKAKDATGLEVLVDLRGCS

Peptide

AKDATGLEVLVDLR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page