top of page

CircRNA

Gene

chr22|27999260|28001373|—|1|ciRNA|TTC28|ENST00000612946.4|13

TTC28

Open Reading Frame (ORF)

MRIVEQAGCPGFHGLCPLCHIKASSPNPLRTPTIQS

Peptide

ASSPNPLRTPTIQS

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page