top of page

CircRNA

Gene

chr22|25038759|25041525|+|1|circRNA|KIAA1671|ENST00000406486.8|6

KIAA1671

CircRNA UID

circKIAA1671(6)

Open Reading Frame (ORF)

MEHASREAPGSLGHSGISPGRRSRRLALTKTPTAVAVEAQWRPRALLTSLQRMTGASRLCGPQYLSTTWRDTQWLTSRDVVSPPHPLVTWPMPVSQNPGRGLRWALGWAGTHQT

Peptide

EAPGSLGHSGISPGR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page