top of page

CircRNA

Gene

chr22|24897971|24912752|+|4|circRNA|SGSM1|ENST00000610372.4|19,20,21,22

SGSM1

Open Reading Frame (ORF)

MAAWMTGRAARPPHLRMRLPGRSWPCRTAWRVTSWPTRAWTSSCPSRAAWTWPCLKRTML

Peptide

MAAWMTGRAARPPHLR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page