top of page

CircRNA

Gene

chr22|24035443|24038461|+|3|circRNA|CABIN1|ENST00000454754.5|2,3,4

CABIN1

CircRNA UID

circCABIN1(2,3,4)

Open Reading Frame (ORF)

LYHKALDLQKHDRFEESAKAYHELLEASLLREESCGLGQPLPVMRSDARGSAESL

Peptide

EESCGLGQPLPVMRSDAR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

10

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page