top of page

CircRNA

Gene

chr22|23714186|23715194|—|2|circRNA|GUSBP11|ENST00000451837.5|3,2

GUSBP11

Open Reading Frame (ORF)

LLWSLLLYTTPPTYIDDVTVTTGVKRDSGEGFCQAPPWTCRFPPASTTSARAGGCGILSAGCGMNGR

Peptide

FPPASTTSARAGGCGILSAGCGMNGR

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page