top of page

CircRNA

Gene

chr22|21958491|21975807|-|16|circRNA|TOP3B|ENST00000357179.9|17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

TOP3B

CircRNA UID

circTOP3B(17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LHCSHCDETYTLPQNGTIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGVSIGNSAVLRKSGV

Peptide

GVSIGNSAVLR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page