top of page

CircRNA

Gene

chr22|19975778|19977414|-|1|ciRNA|ARVCF|ENST00000495096.5|3

ARVCF

Open Reading Frame (ORF)

LGRRELCPTLLIHPFPIWGLPHLWVGRTGVSSLPSQLLPQRKALCTPTAAHHGG

Peptide

TGVSSLPSQLLPQR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page