top of page

CircRNA

Gene

chr22|19187557|19199841|—|6|circRNA|CLTCL1|ENST00000427926.5|29,28,27,26,25,24

CLTCL1

Open Reading Frame (ORF)

LRPICTRAITGGPRAWSSARRIISTRCALPAWMDKSSASHSCVVFTSSFMQMSWRS

Peptide

AITGGPRAWSSAR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page