top of page

CircRNA

Gene

chr22|17683213|17689142|+|2|circRNA|BCL2L13|ENST00000399782.5|4,5

BCL2L13

Open Reading Frame (ORF)

MEDCLAHLGEKVSQELKEPLHKALQMLLSQGSTRYSFTISGSRNFIKS

Peptide

ALQMLLSQGSTR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page