top of page

CircRNA

Gene

chr21|46349011|46385983|+|11|circRNA|PCNT|ENST00000359568.9|7,8,9,10,11,12,13,14,15,16,17

PCNT

CircRNA UID

circPCNT(7,8,9,10,11,12,13,14,15,16,17)

Open Reading Frame (ORF)

LKDQVLSLSHEIEECRSELEVLQQRRERENREGANLLSMLKADVNLSHSERP

Peptide

EGANLLSMLKADVNLSHSERP

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page