top of page

CircRNA

Gene

chr21|46240810|46246886|—|6|circRNA|MCM3AP|NM_003906|26,25,24,23,22,21

MCM3AP

Open Reading Frame (ORF)

LAIKPFHPSANNFPIPLLHMHRNWKRSTECAQEGRIPSTEDLMRGASAEELLAQCLSSSLLLEKEENKRWPMAPSVMVPLMLWRHRRTSWEPVGSCCCFPPK

Peptide

RWPMAPSVMVPLMLWR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page