top of page

CircRNA

Gene

chr21|45537770|45538008|-|1|circRNA|SLC19A1|ENST00000567670.5|2

SLC19A1

CircRNA UID

circSLC19A1(2)

Open Reading Frame (ORF)

LSRMVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFTREQAQRHLRPLRSCTWPEQDGALQPSGGEAGARGTWA

Peptide

NFTREQAQR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page