top of page

CircRNA

Gene

chr21|42518276|42525857|+|2|circRNA|SLC37A1|ENST00000398341.7|3,4

SLC37A1

CircRNA UID

circSLC37A1(3,4)

Open Reading Frame (ORF)

LTFLLYASFHLSRKPISIVKRAEPLPEGRGQDPAGHLLSTLSSLWERQGQQREDLEPGLMTHL

Peptide

GQDPAGHLLSTLSSLWER

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page