top of page

CircRNA

Gene

chr21|41237512|41241939|+|2|circRNA|BACE2|ENST00000487994.5|2,3

BACE2

CircRNA UID

circBACE2(2,3)

Open Reading Frame (ORF)

LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGLAHTAPRALTSQ

Peptide

LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGLAHTAPR

ORF Found in Long-Read

false

Peptide Length

44

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

37

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page