top of page

CircRNA

Gene

chr21|39390697|39391836|+|2|circRNA|WRB|ENST00000333781.9|2,3

WRB

Open Reading Frame (ORF)

MGDKCRFLRIADVQGAAEGRGAGVTDESGDPGHEAGALHSQHDGRVCQICQAGKKDQQDDG

Peptide

IADVQGAAEGR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page