top of page

CircRNA

Gene

chr21|39274373|39280248|-|5|circRNA|BRWD1|ENST00000333229.6|13,12,11,10,9

BRWD1

CircRNA UID

circBRWD1(13,12,11,10,9)

Open Reading Frame (ORF)

LDMATRISGLARWPKALKDTWFPLVLMGQFAFGNGI

Peptide

DTWFPLVLMGQFAFGNGI

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page