top of page

CircRNA

Gene

chr21|39209994|39215362|—|5|circRNA|BRWD1|ENST00000333229.6|36,35,34,33,32

BRWD1

Open Reading Frame (ORF)

MDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAYTPNKRSKEAVCVSLGSQIYRT

Peptide

EAVCVSLGSQIYR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page