top of page

CircRNA

Gene

chr21|34385477|34399899|+|2|circRNA|SMIM11|ENST00000481710.5|3,4

SMIM11

Open Reading Frame (ORF)

LGPPTPLGGSGWSFPSAAASHSSSTTLPTRKEGQSGGGSLAWRPSGQYLAHGKLDPCGLLWFLSTCPCCCISWQQKH

Peptide

KEGQSGGGSLAWRPSGQYLAHGK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page