top of page

CircRNA

Gene

chr21|33856735|33886460|+|10|circRNA|ITSN1|ENST00000381318.7|30,31,32,33,34,35,36,37,38,39

ITSN1

Open Reading Frame (ORF)

LPVLHPRPGAGSPLHHCVREGPVLTRWVFRLTSLGYVDPN

Peptide

EGPVLTR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page