top of page

CircRNA

Gene

chr21|32368402|32385684|—|8|circRNA|URB1|ENST00000382751.3|9,8,7,6,5,4,3,2

URB1

Open Reading Frame (ORF)

LTLLHFLLGLKTAADDDLVADLVVNILKVCPDLLNKYFKEVTFSFIPRAKSTWLNNIKLLNKAWKRLCLLPRSYHEKMCMMLWKGI

Peptide

LCLLPRSYHEK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page