top of page

CircRNA

Gene

chr21|31124521|31266983|—|24|circRNA|TIAM1|ENST00000286827.7|28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5

TIAM1

Open Reading Frame (ORF)

LCRACQTLRRAGFTGMTLHIWLREAGGSIPIHPMGPLSWRRRALRRNAPNLQTSGGRTAWNSHSLI

Peptide

EAGGSIPIHPMGPLSWRR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page