top of page

CircRNA

Gene

chr20|63945650|63946643|—|4|circRNA|UCKL1|NM_001193379|5,4,3,2

UCKL1

Open Reading Frame (ORF)

LYGANVIIFEGIMAFADKTLLEQQCRVPGQAPATCGHWALSPEADHQPVQVRASPAAYKQAYHLHRRAAALVQ

Peptide

ASPAAYKQAYHLHR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page